PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010559155.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 696aa    MW: 75739.7 Da    PI: 6.7922
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010559155.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a k++G   W +I  ++g ++t+ q++s+ qk+
   XP_010559155.1 24 RERWTEEEHDRFLEALKLYGRA-WQKIEDHVG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.86E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.3621973IPR017930Myb domain
TIGRFAMsTIGR015572.1E-172271IPR006447Myb domain, plants
SMARTSM007172.3E-132371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-92464IPR009057Homeodomain-like
PfamPF002491.2E-132467IPR001005SANT/Myb domain
CDDcd001671.07E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
METNSSGEEL VIKMRKPYTI TKQRERWTEE EHDRFLEALK LYGRAWQKIE DHVGTKTAVQ  60
IRSHAQKFFS KVEKEAKAKG VPVGIALNID IPPPRPKKKP SNPYPRKTGN RTPTSQAAAQ  120
VGKQATSAST VLNCKEALLL QKGSLSEYPS EELLPSNLED DHSASSMNKS SVETMAFANG  180
CSFTEFLPPR KEANQDNGTR KASNSEKDCC DLHAKSVQGS AKKYVSGISH VDEEQGPQTY  240
TRHVPVHTID GSSVASPISP FPTVSEGIHV CLNKFTDMSA CANRSKHDND GPRYKSRALP  300
AVHLASAPIP HTLDDYWSFA NLFVSNPLQN PAAHAASTFA ASVWPGGTST CAEIGVPPSQ  360
VSSPSSLAAI AAATVSAATA WWAAHGLLPL CAPIHSAFPC HPPPTTLAPI SDDNGHAPYA  420
NVDTKESTLQ NPSVQSQDAD PEHSEASKAQ SSPLKTTLSP SYSEQSGSTK TETGGKPASH  480
EQTEAETDQN RAKNRKQVDR SSCGSNTPSS SDAEVDASEK LEKDKDEEKE VEVDVNPPAE  540
ESNIRRSRSS SNLSDPWKSV SDEVLGQGRL AFQALFSREV LPQSFPPRRD SKDKKDLRGN  600
EDGEKKKSAE TEHGEGQELD LNRTAQATDS DHQEEKGDQD GYLAIGLGAS KLKERTGFKP  660
YKRCSVDAKE NRITNSSTLN RVEQKDPKRI CLERRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010559158.10.0PREDICTED: protein CCA1-like isoform X1
RefseqXP_010559157.10.0PREDICTED: protein CCA1-like isoform X1
RefseqXP_010559156.10.0PREDICTED: protein CCA1-like isoform X1
RefseqXP_010559155.10.0PREDICTED: protein CCA1-like isoform X1
RefseqXP_010559153.10.0PREDICTED: protein CCA1-like isoform X1
RefseqXP_010559152.10.0PREDICTED: protein CCA1-like isoform X1
RefseqXP_010559151.10.0PREDICTED: protein CCA1-like isoform X1
SwissprotP929731e-157CCA1_ARATH; Protein CCA1
TrEMBLA0A076L4N21e-169A0A076L4N2_9R
STRINGscaffold_403655.11e-159(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-133circadian clock associated 1